DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42514 and Slc35a3

DIOPT Version :9

Sequence 1:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001012082.1 Gene:Slc35a3 / 310808 RGDID:1308615 Length:326 Species:Rattus norvegicus


Alignment Length:267 Identity:59/267 - (22%)
Similarity:102/267 - (38%) Gaps:68/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RTVLQWAWHVVKSTSVEPTMFLYMFAFMITSVVEQNFFLYK--SCRVNRNFTEEICRNLNKPENE 106
            ||:.:.....:.||:|....||.:.|.:        |.:||  .|.|         |.||:..::
  Rat    28 RTLKEEGPRYLSSTAVVVAEFLKIMACI--------FLVYKDSKCSV---------RTLNRVLHD 75

  Fly   107 EFRTKAMLT--------------NAWFLQWENISAHVFPI-----ILALFLGSFSDRRGRKLPLL 152
            |...|.|.|              |..::...|:.|..:.:     ||...|.|.| ..|:||   
  Rat    76 EILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVS-MLGKKL--- 136

  Fly   153 MGLVGKFFYSTMIVVNA--RMTTWPVQNIIYSATLPS--ALTGAD--------VAIFASCFA--Y 203
                |.:.:.:::::.|  ....||..    |..|.|  ..||:.        :|.|:|.||  |
  Rat   137 ----GMYQWLSLVILMAGVAFVQWPSD----SQELNSKDLSTGSQFVGLMAVLIACFSSGFAGVY 193

  Fly   204 ISDISSLQQRTIRVTILDVIYLSAM--PMGVAL--GSHLFYNVFNQSYADMFTVNASLLALAIIY 264
            ...|....::::.:..:.:.:..::  .|||.:  |..:..|.|.|.|..:..:...|.||..:.
  Rat   194 FEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNQLTWIVVVLQALGGLV 258

  Fly   265 TLCALKW 271
            ....:|:
  Rat   259 IAAVIKY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 36/166 (22%)
MFS 132..495 CDD:119392 36/163 (22%)
Slc35a3NP_001012082.1 Nuc_sug_transp 1..314 CDD:398009 59/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.