DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42514 and Mfsd10

DIOPT Version :9

Sequence 1:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001178609.1 Gene:Mfsd10 / 305449 RGDID:1311900 Length:456 Species:Rattus norvegicus


Alignment Length:369 Identity:73/369 - (19%)
Similarity:136/369 - (36%) Gaps:92/369 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GSFSDRRGRKLPLLMGLVGKFFYSTMIVVNARMTTWPVQNIIYSATLPSALTGADVAIFASCFAY 203
            |:.||..||:..::|.|.|......:...:...|.:....:|      ..::..:|.:..   |.
  Rat   109 GAASDYLGRRPVMMMSLTGLAISYAVWATSRSFTAFLASRVI------GGISKGNVNLST---AI 164

  Fly   204 ISDISSLQQRTIRVTILDVIYLSAMPMGVALGSHLFYNVFNQSYADMFTVNASLLALA-IIYTLC 267
            ::|:.|...|:..:.::.|.:..|..:|..||:.|        ..:|....:.|.|:: :::..|
  Rat   165 VADLGSPPTRSQGMAVIGVAFSLAFTLGPMLGAFL--------SVEMVPWISLLFAVSDMLFIFC 221

  Fly   268 ALKWQTTPRQR--SLRELGCCGFWGDFFDKQHVKDSLAVLVKPRKGHRRS--------------- 315
            .|. :|.|:::  |...||       |....::...||:|......|.:.               
  Rat   222 FLP-ETLPQEKRASSVTLG-------FHTAANLLSPLALLRFAAVAHSQDPPTEDGLRNLRRLGL 278

  Fly   316 --FLIILLVS-----MALYTFQR------DEGQYLYMYTLGKFDWDVSAYSNFKTFKSSAYV-IA 366
              ||.:.|.|     ::..|.||      .:|:..:...|.......:.....:..|.:|.| .|
  Rat   279 VYFLYLFLFSGLEYTLSFLTHQRFQFSSLQQGKMFFFIGLTMATIQGTYARRIRPGKEAAAVKRA 343

  Fly   367 MLLAVPLMNKILGWRDTTIIFIGTWAHSIARLFFYFATNTDLLYAGAVVCSLGPIVGPMIRAMTS 431
            |||.||           ..:.|| |.||:..|....     :||:.|..     :|.|.:..|.|
  Rat   344 MLLLVP-----------AFLLIG-WGHSLPMLGLGL-----MLYSFAAA-----VVVPGLSTMVS 386

  Fly   432 KIVPTSERGKVFALL-----------SVCDNAVPFISG--VCYS 462
            ......::|.:..:|           .:...:|.:::|  ||::
  Rat   387 SYGSPGQKGTIMGILRSLGALGRAVGPIMAASVYWLTGAQVCFT 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 70/361 (19%)
MFS 132..495 CDD:119392 73/369 (20%)
Mfsd10NP_001178609.1 MFS_MFSD10 52..434 CDD:340947 73/369 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.