DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42514 and acy-4

DIOPT Version :9

Sequence 1:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_504486.4 Gene:acy-4 / 178949 WormBaseID:WBGene00000071 Length:1013 Species:Caenorhabditis elegans


Alignment Length:287 Identity:55/287 - (19%)
Similarity:87/287 - (30%) Gaps:101/287 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YKSCRVNRNFTEEICRNLNKPENEEFRTKAMLTNAWFLQWENISAHV--FPIILALFLG-SFSDR 144
            ||..||...|..                         |::::|...|  :..|:|:.:| .|.  
 Worm   564 YKQVRVENKFVR-------------------------LKYKDIPFQVTLYVAIVAICIGIKFG-- 601

  Fly   145 RGRKLPLLMGLVGKFFYSTM-IVVNARMTTWPVQNIIYSATLPSALTGADVAIFASCFAYISDIS 208
                   ||.||...|...| ||:.:.|.....:.:|..|.|.|.:.|.       .|..:|   
 Worm   602 -------LMNLVSFSFVPQMFIVLTSVMIFILTRALIKHARLVSLVIGV-------LFILLS--- 649

  Fly   209 SLQQRTIRVTILDVIYLSAMPMGVALGSHLFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQT 273
                  |::.||..:|.|.....|.       ..|..:|.|.|.          |:.:|.|    
 Worm   650 ------IQIVILMGMYESKFTCDVE-------KCFKNNYTDFFE----------IFEICTL---- 687

  Fly   274 TPRQRSLRELGCCGFWGDFFDKQHVK----DSLAVLVKPR----------KGHRRSFLIILLVSM 324
                     ..|.....||..|..:.    .|..||:..:          .....:|.::..:::
 Worm   688 ---------ATCVILSVDFMTKLLMSMIYFSSFTVLITAKLIRINQYEALLSTYANFCVLSCLTL 743

  Fly   325 ALYTFQRDEGQYLYMYTLGKFDWDVSA 351
            .|..|.....:.:..|   .|.|.:.|
 Worm   744 LLVVFSTRRSELISRY---DFIWKLQA 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 48/241 (20%)
MFS 132..495 CDD:119392 47/236 (20%)
acy-4NP_504486.4 AC_N <50..291 CDD:292831
CYCc 260..451 CDD:214485
Guanylate_cyc 293..448 CDD:278633
CYCc 778..984 CDD:214485
Guanylate_cyc 807..1003 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4862
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.