DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42514 and acy-3

DIOPT Version :9

Sequence 1:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_497765.4 Gene:acy-3 / 175489 WormBaseID:WBGene00000070 Length:1243 Species:Caenorhabditis elegans


Alignment Length:200 Identity:41/200 - (20%)
Similarity:79/200 - (39%) Gaps:61/200 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 TNAW----FLQWEN-ISAHVFPIILALFLGSFSDRRGRKLPLLMGLVGKFF--YSTMIVVNARMT 172
            ::.|    :|.|.: .||.:..|:|.:..||...|       .:|.:..|:  ::.:|::.:.:|
 Worm     4 SSEWLEQSYLDWRHAASARLIRIVLFITSGSAFLR-------TLGHIPGFYALWTAVILLLSTVT 61

  Fly   173 TWPVQNIIYSATLPSALTGADVAIFASCFAYISDISSLQQRTIRVTILDVIYLSAMPMGVALGSH 237
                  ||:....|:.:         :.|..::.|         |.:|||.:  |:|        
 Worm    62 ------IIFHILRPARI---------AAFQILAGI---------VLLLDVAF--ALP-------- 92

  Fly   238 LFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPRQRSLREL-GCCGFWGDFFDKQHVKDS 301
                    .|..:|   .:|||:..:||..:|.:.......:|..: ..|.|. .|.:..|..:.
 Worm    93 --------GYESLF---PALLAVFSLYTFFSLPFYAILATSTLISIVQTCSFL-LFVEPLHTNEL 145

  Fly   302 LAVLV 306
            ||::|
 Worm   146 LAIIV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 35/180 (19%)
MFS 132..495 CDD:119392 35/177 (20%)
acy-3NP_497765.4 TctB 26..137 CDD:284693 31/163 (19%)
CYCc 195..378 CDD:214485
Nucleotidyl_cyc_III 221..382 CDD:299850
CYCc 696..873 CDD:214485
Nucleotidyl_cyc_III 711..880 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4862
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.