Sequence 1: | NP_730171.1 | Gene: | CG42514 / 8674108 | FlyBaseID: | FBgn0260388 | Length: | 533 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497765.4 | Gene: | acy-3 / 175489 | WormBaseID: | WBGene00000070 | Length: | 1243 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 41/200 - (20%) |
---|---|---|---|
Similarity: | 79/200 - (39%) | Gaps: | 61/200 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 TNAW----FLQWEN-ISAHVFPIILALFLGSFSDRRGRKLPLLMGLVGKFF--YSTMIVVNARMT 172
Fly 173 TWPVQNIIYSATLPSALTGADVAIFASCFAYISDISSLQQRTIRVTILDVIYLSAMPMGVALGSH 237
Fly 238 LFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPRQRSLREL-GCCGFWGDFFDKQHVKDS 301
Fly 302 LAVLV 306 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42514 | NP_730171.1 | MFS_1 | 129..458 | CDD:284993 | 35/180 (19%) |
MFS | 132..495 | CDD:119392 | 35/177 (20%) | ||
acy-3 | NP_497765.4 | TctB | 26..137 | CDD:284693 | 31/163 (19%) |
CYCc | 195..378 | CDD:214485 | |||
Nucleotidyl_cyc_III | 221..382 | CDD:299850 | |||
CYCc | 696..873 | CDD:214485 | |||
Nucleotidyl_cyc_III | 711..880 | CDD:299850 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S4862 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |