DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42514 and AgaP_AGAP000387

DIOPT Version :9

Sequence 1:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_310718.5 Gene:AgaP_AGAP000387 / 1271863 VectorBaseID:AGAP000387 Length:359 Species:Anopheles gambiae


Alignment Length:221 Identity:42/221 - (19%)
Similarity:77/221 - (34%) Gaps:84/221 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PVQNII--YSATLPSA-------------LTGADVAIFASCFAYISDISSLQQRTIRVTILDV-- 222
            |.||.:  :||.|.:.             |.|||::|:              .|.|::::|.:  
Mosquito   183 PEQNRLLGFSAALGACFLSGLAGIYFEKMLKGADISIW--------------MRNIQLSLLSLPF 233

  Fly   223 -IYLSAMPMGVALGSHLFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPRQRSLRELGCC 286
             :...|:..|..|.:..|:          |..:|.::.|.::..:..|                 
Mosquito   234 GLLTCAVNDGAQLAARGFF----------FGYDAFVVYLVVLQAVGGL----------------- 271

  Fly   287 GFWGDFFDKQHVKDSLAVLVKPR----KGHRRSFLIILLVSMALYTF------QRDEGQYLYMYT 341
                          .:||:||..    ||...|..||:....::|.|      |...|..|.:.:
Mosquito   272 --------------IVAVVVKYADNILKGFATSLAIIISCVASIYLFDFSLSLQFTVGAGLVIGS 322

  Fly   342 LGKFDWDVSAYSNFKT-FKSSAYVIA 366
            :..:.:|.:|....|: .:.||..:|
Mosquito   323 IFLYGYDPAAAKGAKSAVRPSAKALA 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 42/221 (19%)
MFS 132..495 CDD:119392 42/221 (19%)
AgaP_AGAP000387XP_310718.5 Nuc_sug_transp 8..327 CDD:282054 36/198 (18%)
EamA 90..326 CDD:304911 36/197 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.