DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42578 and CG42577

DIOPT Version :9

Sequence 1:NP_001162807.1 Gene:CG42578 / 8674106 FlyBaseID:FBgn0260868 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001162806.1 Gene:CG42577 / 8673999 FlyBaseID:FBgn0260867 Length:92 Species:Drosophila melanogaster


Alignment Length:92 Identity:84/92 - (91%)
Similarity:85/92 - (92%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEKSNAKAKPTGNNEFLMTEDPEQPSGSKEGSQSSEAEEEHISEAFHRLEEKLNDMERRIAHAR 65
            |.|||||||.|.|:||.||||||||.|||||||||||||||||||||.|||||||||||||||||
  Fly     1 MPEKSNAKANPIGSNEVLMTEDPEQSSGSKEGSQSSEAEEEHISEAFQRLEEKLNDMERRIAHAR 65

  Fly    66 KVKRRLFVRLLCLILDLLQAKLYLQNT 92
            |||||||||||||||||||||||||.|
  Fly    66 KVKRRLFVRLLCLILDLLQAKLYLQYT 92



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007615
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.