DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42583 and karr

DIOPT Version :10

Sequence 1:NP_001162803.1 Gene:CG42583 / 8674103 FlyBaseID:FBgn0260873 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_652406.1 Gene:karr / 50257 FlyBaseID:FBgn0040784 Length:97 Species:Drosophila melanogaster


Alignment Length:89 Identity:33/89 - (37%)
Similarity:50/89 - (56%) Gaps:5/89 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEKSNAEAKPTGKNEFLMTEDPEHPSGSKEGSPSSGSSSSTTEASLNTINVSTQRLHEKLEDLE 65
            |||||||:||.:..|:::.:||||.||.|.........||.:.|....  ||| :|..:.::||:
  Fly     1 MAEKSNADAKASKNNKYMTSEDPEQPSESSTQKEKGSQSSESEEEYFK--NVS-ERFDKDIKDLK 62

  Fly    66 R--QMDQDEIMNEHFIRLMAVIRM 87
            .  .:::.|.....|.||:.|||:
  Fly    63 DLIALNEKECNRLLFDRLLDVIRV 86

Return to query results.
Submit another query.