DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBIP1 and Bbip1

DIOPT Version :10

Sequence 1:NP_001163568.1 Gene:BBIP1 / 8674100 FlyBaseID:FBgn0260237 Length:76 Species:Drosophila melanogaster
Sequence 2:XP_006526610.1 Gene:Bbip1 / 100503572 MGIID:1913610 Length:95 Species:Mus musculus


Alignment Length:68 Identity:25/68 - (36%)
Similarity:39/68 - (57%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AEVLQKIDLIEPTTGKLFFEHKTELLFCRPHLMPLKTQALERLEEMH---RDTARQLQKKRQQKK 67
            |||......:.|..|:|..|..|.::.|:|.|:|||:..||:||:|.   :||.||    ::..:
Mouse    30 AEVKSMFREVLPKQGQLSVEDVTTMVLCKPKLLPLKSLTLEKLEKMQQAAQDTVRQ----QEMAE 90

  Fly    68 KST 70
            |:|
Mouse    91 KAT 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBIP1NP_001163568.1 BBIP10 6..>53 CDD:464310 19/49 (39%)
Bbip1XP_006526610.1 BBIP10 29..91 CDD:464310 23/64 (36%)

Return to query results.
Submit another query.