DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and Pp1-Y1

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster


Alignment Length:270 Identity:110/270 - (40%)
Similarity:160/270 - (59%) Gaps:19/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 IEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDYV 194
            :.||..::::::...:|.:|..::.:||||.|.||||||:.||::.||..|.|...:||.|||||
  Fly    35 VPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLRYFETSGHPPKKRYLMLGDYV 99

  Fly   195 DRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCL 259
            |||.:|:|.:..|.:.|:.||.::.|||||||...:..|:.|..|||.:::.|::...:|.:|||
  Fly   100 DRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDECKRRFTIRLWRMFVDCYDCL 164

  Fly   260 PLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLED---FGNEKNSDF 321
            |:||::|.:..|.||||||.:|.|.||:.|.|..|....|.:||||||||  |   .|.||||  
  Fly   165 PVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDLLWSDP--DPTAIGWEKNS-- 225

  Fly   322 YTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYL 386
                  ||.|:.:.......||...:...|.|||:..:.||..:.|.|      |||:|||.||.
  Fly   226 ------RGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQ------LITVFSAVNYC 278

  Fly   387 DVYNNKAAVL 396
            ..::|..|::
  Fly   279 GEFDNAGAMM 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 110/270 (41%)
PP2Ac 132..403 CDD:197547 110/268 (41%)
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 110/270 (41%)
PP2Ac 36..305 CDD:197547 110/269 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.