DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and Ppp4c

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001347393.1 Gene:Ppp4c / 56420 MGIID:1891763 Length:307 Species:Mus musculus


Alignment Length:274 Identity:113/274 - (41%)
Similarity:162/274 - (59%) Gaps:15/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 IEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDYV 194
            |:||....:..:...:|..|..:..:::|||||||||||||||.:||.:||....|.|||:||:|
Mouse    20 IKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFV 84

  Fly   195 DRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFDC 258
            |||::|:|..|.|.:||:.||..:.|:|||||.|.:|:.:.|..||..|| |..|:..|.:.||.
Mouse    85 DRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDY 149

  Fly   259 LPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYT 323
            |.|:|:::.:..||||||||.|..|:.||.:||.:|.|..|||||||||||.:..|        .
Mouse   150 LSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTG--------W 206

  Fly   324 HNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDV 388
            ..|.||..|.:.......|...|::..|.|||:....||:.:...      :::|::|||||...
Mouse   207 GVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNE------TVLTVWSAPNYCYR 265

  Fly   389 YNNKAAVLKYENNV 402
            ..|.||:|:.:.::
Mouse   266 CGNVAAILELDEHL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 113/274 (41%)
PP2Ac 132..403 CDD:197547 112/272 (41%)
Ppp4cNP_001347393.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 113/274 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.