DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and PPP1CB

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_002700.1 Gene:PPP1CB / 5500 HGNCID:9282 Length:327 Species:Homo sapiens


Alignment Length:264 Identity:106/264 - (40%)
Similarity:159/264 - (60%) Gaps:19/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 TEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWSLKI 212
            ::..::::|||:.:|||||||:.||::|||.||.|....|||||||||||..|:|.:..|.:.||
Human    47 SQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKI 111

  Fly   213 TYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLS 277
            .||:..|||||||||..:...:.|..|||.:::.:::....|.|:|||:||:::::..|.|||||
Human   112 KYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLS 176

  Fly   278 PEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDF 342
            |::..:|.|||:.|..:.|..|.:||||||||.:|......:|       ||.|:.:.......|
Human   177 PDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGEND-------RGVSFTFGADVVSKF 234

  Fly   343 LQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQ 407
            |..::|..|.|||:..:.||..:.|.|      |:|:||||||...::|...::..:..:|    
Human   235 LNRHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGGMMSVDETLM---- 289

  Fly   408 FNCS 411
              ||
Human   290 --CS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 106/264 (40%)
PP2Ac 132..403 CDD:197547 103/254 (41%)
PPP1CBNP_002700.1 MPP_PP1_PPKL 7..297 CDD:277359 106/264 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.