DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and PpY-55A

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster


Alignment Length:349 Identity:114/349 - (32%)
Similarity:184/349 - (52%) Gaps:49/349 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VLKQHFILEG---RIEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGG 180
            ::|:...|.|   .::|....|:||:...:::.:..:::::|||.:||||||||.||:::|:..|
  Fly    12 IIKELTSLNGSECTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIFKACG 76

  Fly   181 SPATTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYS 245
            .|....|||||||||||..|:|.:..|::.|:.||...||||||||...:.:.:.|..|.|.:::
  Fly    77 FPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDEIKRRHT 141

  Fly   246 ERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPL 310
            .|::.:..|.|:.||:|||:.::..|.||||||.:..|:.|..:.|..:.|..|.||||||:|  
  Fly   142 VRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDLLWAD-- 204

  Fly   311 EDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS 375
                ....:..:.||. ||.|:.:......|||:..:|..::||||..:.||..:...|      
  Fly   205 ----LNHTTKGWGHND-RGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQ------ 258

  Fly   376 LITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLV 440
            |:|:||||||..:.||...|:....:::      ||            |...||....|:     
  Fly   259 LVTVFSAPNYCGMMNNAGGVMSVSTDLI------CS------------FVIILPCHKYKM----- 300

  Fly   441 NVLNICSDDELMTEESEEPLSDDE 464
                      :.|:.::.|.:::|
  Fly   301 ----------IATDANQMPTNEEE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 107/302 (35%)
PP2Ac 132..403 CDD:197547 102/270 (38%)
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 112/343 (33%)
MPP_PP1_PPKL 8..294 CDD:277359 108/312 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.