DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and Pp1-13C

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster


Alignment Length:305 Identity:114/305 - (37%)
Similarity:176/305 - (57%) Gaps:28/305 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VFDARTGKPQHDVLKQHFILEGRIEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYD 171
            :.:.|..:|..:|         ::.|.....:..:...:|..:..::::|||:.:|||||||:||
  Fly    14 LLEVRGARPGKNV---------QLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYD 69

  Fly   172 LMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTF 236
            |::|||.||.|....|||||||||||..|:|.:..|.:.||.|.:..|||||||||..:...:.|
  Fly    70 LLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGF 134

  Fly   237 KQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPM 301
            ..|||.:|:.:::....|.|:|||:.|:::::..|.||||||::..:|.|||:.|..:.|..|.:
  Fly   135 YDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLL 199

  Fly   302 CDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYR 366
            ||||||||      :|::..:..|. ||.|:.:.......|||.::|..|.|||:..:.||..:.
  Fly   200 CDLLWSDP------DKDTIGWGEND-RGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFA 257

  Fly   367 KSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 411
            |.|      |:|:||||||...::|..|::..:|.:|      ||
  Fly   258 KRQ------LVTLFSAPNYCGEFDNAGAMMSVDNTLM------CS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 113/297 (38%)
PP2Ac 132..403 CDD:197547 108/270 (40%)
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 114/305 (37%)
MPP_PP1_PPKL 6..296 CDD:277359 114/305 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438849
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.