DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and mts

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster


Alignment Length:286 Identity:119/286 - (41%)
Similarity:168/286 - (58%) Gaps:16/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 RIEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDY 193
            ::.|:....:..:...:|..|..:.:::.|||||||:||||:|||:||.|||....|.|||:|||
  Fly    22 QLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDY 86

  Fly   194 VDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFD 257
            |||||:|:|.|..|.:||:.|.:.:.:||||||.|.:|:.:.|..||..|| :..|:....|.||
  Fly    87 VDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFD 151

  Fly   258 CLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFY 322
            .|||.||::.|..|:||||||.|..|:.||.|||.:|.|..||||||||||| :|.|.       
  Fly   152 YLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDP-DDRGG------- 208

  Fly   323 THNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLD 387
            ...|.||..|.:.......|...|.|..:.|||:....||......      :::||||||||..
  Fly   209 WGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDR------NVVTIFSAPNYCY 267

  Fly   388 VYNNKAAVLKYENNV-MNIRQFNCSP 412
            ...|:||:::.:::: .:..||:.:|
  Fly   268 RCGNQAALMELDDSLKFSFLQFDPAP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 119/286 (42%)
PP2Ac 132..403 CDD:197547 116/272 (43%)
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 118/284 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438815
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.