DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and CG11597

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster


Alignment Length:278 Identity:117/278 - (42%)
Similarity:156/278 - (56%) Gaps:23/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWS 209
            ||..|..::.:::|..|||||||||.||:.|.|:|||....:||||||.||||..|:|..|.|.:
  Fly    43 LLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAA 107

  Fly   210 LKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFDCLPLAALMNQQFLCVH 273
            ||:.:|..:.|||||||||..|..:.|.:||..:| |..|:..|...||.|||||:::...||||
  Fly   108 LKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVH 172

  Fly   274 GGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAA 338
            |||||::..|:|:|.|||..|.|..|.:.|||||||.|..|        ...|.||....:....
  Fly   173 GGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPG--------WAASPRGHGKLFGGDV 229

  Fly   339 CCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS-LITIFSAPNYLDVYNNKAAVLK----- 397
            ..:|.:.|.:..|.|||:....|:|.:       |.. |:||:|||||.....||||:|:     
  Fly   230 VEEFTRANGISLICRAHQLAQDGFRWH-------FGQLLVTIWSAPNYCYRCGNKAAILRLNAAG 287

  Fly   398 -YENNVMNIRQFNCSPHP 414
             |:..|...:..:..|.|
  Fly   288 DYDFKVFEAQALHSKPQP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 117/278 (42%)
PP2Ac 132..403 CDD:197547 114/265 (43%)
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 117/278 (42%)
MPP_superfamily 12..296 CDD:301300 115/267 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438867
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.