DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and PpN58A

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster


Alignment Length:253 Identity:102/253 - (40%)
Similarity:146/253 - (57%) Gaps:15/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWS 209
            :|..:.|:::|.||:.:.||||||:.:|::.||..|.|..:.||.||||||||..|||.:..|.:
  Fly    58 VLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLA 122

  Fly   210 LKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHG 274
            ||..||...:||||||||..:..::.|..|||.:|:.:::...:|.::||||||::.:...|.||
  Fly   123 LKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHG 187

  Fly   275 GLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDP-LEDFGNEKNSDFYTHNSVRGCSYFYSYAA 338
            ||||.:..::.||.:.|..|.|..|.:||:||||| |...|...|.        ||.|:.:....
  Fly   188 GLSPHLFSMQQIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNE--------RGVSHTFGSDV 244

  Fly   339 CCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVL 396
            ...||....|..|.|.|:..:.||..:.|.|      ||||||||||...::|..|::
  Fly   245 VSAFLHRFKLNLICRGHQVVEDGYEFFAKRQ------LITIFSAPNYCGEFDNAGAMM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 102/253 (40%)
PP2Ac 132..403 CDD:197547 102/253 (40%)
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 102/253 (40%)
MPP_superfamily 23..311 CDD:301300 102/253 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438872
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.