DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:337 Identity:112/337 - (33%)
Similarity:166/337 - (49%) Gaps:52/337 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PSSPTKRSTISTKERVIDSVAFPPSRKLTCADVFDARTGKPQHDVLKQHFILEGRIEESAALRII 139
            |.||..|...:...|:..|  :.|.   .|..:|                      :|...:.|.
 Worm     8 PGSPLHRKLTNVIFRLTQS--WSPG---NCQTLF----------------------QEKEIIEIC 45

  Fly   140 QEGATLLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSP------ATTKYLFLGDYVDRGY 198
            .........|...::||||||:||||||||.||:.:|:|.|.|      .:::|||||||:|||.
 Worm    46 YRAREAFWKEPMKLEIEAPVTICGDIHGQFEDLLSMFDIYGFPHVSQKDKSSRYLFLGDYIDRGP 110

  Fly   199 FSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAA 263
            ||||.:..|::.::.:||.:||||||||.|.:...:.|..|||.:||..:|:....||.|:||.|
 Worm   111 FSIEVITLLFAYRLLHPQKMFLLRGNHESRPVNMQYGFYNECKRRYSVTLYETFQWAFYCMPLCA 175

  Fly   264 LMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAF---GPMCDLLWSDPLEDFGNEKNSDFYTHN 325
            ::..:.:|:|||:...:..||.|   |.|:.|...   |...||.|:||:......::|.     
 Worm   176 IVGGRIMCMHGGIPFGLLSLEQI---DEFQRPTDIADVGIPSDLCWADPVSGVVGFQDSP----- 232

  Fly   326 SVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYN 390
              ||..:.:..|...:|.:...|..|:|||:....||..:...:      |:||||||.|...::
 Worm   233 --RGAGHVFGEATVKEFNEKFKLDLIVRAHQVVMDGYEFFADKK------LVTIFSAPCYCGHFD 289

  Fly   391 NKAAVLKYENNV 402
            |..|||:...|:
 Worm   290 NLGAVLQVATNM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 103/297 (35%)
PP2Ac 132..403 CDD:197547 103/280 (37%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 104/304 (34%)
MPP_superfamily 36..304 CDD:301300 104/304 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.