DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and Pp1-Y2

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster


Alignment Length:264 Identity:102/264 - (38%)
Similarity:153/264 - (57%) Gaps:19/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 TEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWSLKI 212
            ::..::::.|||.:||||||||.||::||:.||.|..:.|||||||||||..|||.:..|.:.||
  Fly    50 SQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKI 114

  Fly   213 TYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLS 277
            .||:..||||||||...:...:.|..|||.:|:.:::...:|.:.|:|::|:::::..|.|||||
  Fly   115 KYPENFFLLRGNHESAGINRIYGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLS 179

  Fly   278 PEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDF 342
            |::..:..|.:|.|..:.|..|.:||||||||........::|       ||.|..:.......|
  Fly   180 PDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPKIMGWSDND-------RGVSVTFGADIVGKF 237

  Fly   343 LQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQ 407
            :..:....|.|||:..:.||..:.|.|      ||||||||||...::|..|::..:..:|    
  Fly   238 VHRHKFDLICRAHQVVEDGYEFFAKRQ------LITIFSAPNYCGEFDNAGAMMSVDETLM---- 292

  Fly   408 FNCS 411
              ||
  Fly   293 --CS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 102/264 (39%)
PP2Ac 132..403 CDD:197547 99/254 (39%)
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 102/264 (39%)
MPP_PP1_PPKL 13..300 CDD:277359 102/264 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438754
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.