DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and Ppp1cc

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001257912.1 Gene:Ppp1cc / 24669 RGDID:3377 Length:337 Species:Rattus norvegicus


Alignment Length:305 Identity:114/305 - (37%)
Similarity:177/305 - (58%) Gaps:28/305 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VFDARTGKPQHDVLKQHFILEGRIEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYD 171
            :.:.|..||..:|         :::|:....:..:...:..::..::::|||:.:|||||||:||
  Rat    16 LLEVRGSKPGKNV---------QLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71

  Fly   172 LMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTF 236
            |::|||.||.|..:.|||||||||||..|:|.:..|.:.||.||:..|||||||||..:...:.|
  Rat    72 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 136

  Fly   237 KQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPM 301
            ..|||.:|:.:::....|.|:|||:||:::::..|.||||||::..:|.|||:.|..:.|..|.:
  Rat   137 YDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   302 CDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYR 366
            ||||||||.:|......:|       ||.|:.:.......||..::|..|.|||:..:.||..:.
  Rat   202 CDLLWSDPDKDVLGWGEND-------RGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFA 259

  Fly   367 KSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 411
            |.|      |:|:||||||...::|..|::..:..:|      ||
  Rat   260 KRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM------CS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 112/297 (38%)
PP2Ac 132..403 CDD:197547 107/270 (40%)
Ppp1ccNP_001257912.1 MPP_PP1_PPKL 8..298 CDD:277359 114/305 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.