DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and Ppp1ca

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_113715.1 Gene:Ppp1ca / 24668 RGDID:3375 Length:330 Species:Rattus norvegicus


Alignment Length:329 Identity:120/329 - (36%)
Similarity:186/329 - (56%) Gaps:38/329 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ISTKERV-IDSVAFPPSRKLTCADVFDARTGKPQHDVLKQHFILEGRIEESAALRIIQEGATLLR 147
            :|..|:: :||:.   .|.|   :|..:|.||            ..::.|:....:..:...:..
  Rat     1 MSDSEKLNLDSII---GRLL---EVQGSRPGK------------NVQLTENEIRGLCLKSREIFL 47

  Fly   148 TEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWSLKI 212
            ::..::::|||:.:|||||||:|||::|||.||.|..:.|||||||||||..|:|.:..|.:.||
  Rat    48 SQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKI 112

  Fly   213 TYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLS 277
            .||:..|||||||||..:...:.|..|||.:|:.:::....|.|:|||:||:::::..|.|||||
  Rat   113 KYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLS 177

  Fly   278 PEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDF 342
            |::..:|.|||:.|..:.|..|.:||||||||.:|......:|       ||.|:.:.......|
  Rat   178 PDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGEND-------RGVSFTFGAEVVAKF 235

  Fly   343 LQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQ 407
            |..::|..|.|||:..:.||..:.|.|      |:|:||||||...::|..|::..:..:|    
  Rat   236 LHKHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM---- 290

  Fly   408 FNCS 411
              ||
  Rat   291 --CS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 110/297 (37%)
PP2Ac 132..403 CDD:197547 107/270 (40%)
Ppp1caNP_113715.1 MPP_PP1_PPKL 8..298 CDD:277359 118/322 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.