DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanA-14F and F44B9.9

DIOPT Version :9

Sequence 1:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:270 Identity:80/270 - (29%)
Similarity:117/270 - (43%) Gaps:91/270 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LLRTEKTMIDIEAPVTVCGDIHGQFYDLMKLFEIGGSP-----------ATTKYLFLGDYVDRGY 198
            |.:.|||:.:|..|||:.|||||||.||::|.....|.           :|.|::||||||||||
 Worm    19 LFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIYGFSTKKWVFLGDYVDRGY 83

  Fly   199 FSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAA 263
            .|::|:..::||||.:|:...|||||||.|.:          ..:|..||....:     |.:.|
 Worm    84 KSLDCICLVFSLKICFPKQYILLRGNHETRAI----------NFRYGFRVCSVVV-----LKIPA 133

  Fly   264 LMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVR 328
                                           .|:|                        ..|:.|
 Worm   134 -------------------------------KPSF------------------------IRNNKR 143

  Fly   329 GCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMY--RKSQTTGFPSLITIFSAPNYLDVYNN 391
            |.|..::.||..:..:..|:..|:|.|:...||::.:  ||        |.||||||.|::..:|
 Worm   144 GLSVCFNEAAVNETCRLLNISLIVRGHQMMPAGFKFFADRK--------LCTIFSAPRYMNEIDN 200

  Fly   392 KAAVLKYENN 401
            ..||:|..:|
 Worm   201 SGAVMKVASN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 80/270 (30%)
PP2Ac 132..403 CDD:197547 80/270 (30%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 80/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.