DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24Bb and Sfp24Ba

DIOPT Version :10

Sequence 1:NP_001162861.1 Gene:Sfp24Bb / 8674094 FlyBaseID:FBgn0259952 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001162859.1 Gene:Sfp24Ba / 8673984 FlyBaseID:FBgn0259951 Length:121 Species:Drosophila melanogaster


Alignment Length:81 Identity:28/81 - (34%)
Similarity:40/81 - (49%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFVILLSLMCIGIGYAQQQSEVKCFMDAIPVGECGSRIIGYSYSSVRARCVNYETIGCEVIGNFF 66
            |||::..|    |.|...||...|....|..|.|...|.|:::::...||..:...||.|.||:|
  Fly     4 KFVVITFL----ISYVLAQSNADCGNKPIVDGNCDQIIKGFTFATEENRCKKFRAKGCTVGGNYF 64

  Fly    67 TDRKVCEAKCKPPISF 82
            ..:..||.|||..|::
  Fly    65 RAKDECELKCKGYINW 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24BbNP_001162861.1 None
Sfp24BaNP_001162859.1 Kunitz-type 18..74 CDD:444694 18/55 (33%)

Return to query results.
Submit another query.