DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and KCNK6

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_004814.1 Gene:KCNK6 / 9424 HGNCID:6281 Length:313 Species:Homo sapiens


Alignment Length:287 Identity:64/287 - (22%)
Similarity:103/287 - (35%) Gaps:110/287 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 AGGVG--------GVAVGGGPPHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGI 640
            ||.:|        |.|....|  .|:||.|..::.|::||:|||...|.|..|:..::|:|..|:
Human    69 AGRLGRVVLANASGSANASDP--AWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFALLGV 131

  Fly   641 PLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQA 705
            |.|::.|:::...|:.:...|    ....|....|   :|.:|.|                    
Human   132 PTTMLLLTASAQRLSLLLTHV----PLSWLSMRWG---WDPRRAA-------------------- 169

  Fly   706 VMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPIL- 769
                                                                ..|.:::|..:: 
Human   170 ----------------------------------------------------CWHLVALLGVVVT 182

  Fly   770 LCFSMMIIYIVFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTW------FC 828
            :||  ::..::|.    :..|.|..||..||||:||||||.||.:||   |:....:      ..
Human   183 VCF--LVPAVIFA----HLEEAWSFLDAFYFCFISLSTIGLGDYVPG---EAPGQPYRALYKVLV 238

  Fly   829 SVYIMSG---MTLTAMCFNVIHEEIVH 852
            :||:..|   |.|....|.  |...:|
Human   239 TVYLFLGLVAMVLVLQTFR--HVSDLH 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 20/56 (36%)
Ion_trans <601..640 CDD:278921 14/38 (37%)
Ion_trans_2 774..846 CDD:285168 26/80 (33%)
KCNK6NP_004814.1 Ion_trans_2 <91..146 CDD:285168 19/54 (35%)
Ion_trans_2 180..256 CDD:285168 27/84 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 288..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.