DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and TOK1

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_012442.1 Gene:TOK1 / 853352 SGDID:S000003629 Length:691 Species:Saccharomyces cerevisiae


Alignment Length:352 Identity:73/352 - (20%)
Similarity:126/352 - (35%) Gaps:110/352 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   607 LYSLTV-LTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVF-------- 662
            ||..|| |.|:|.|::.|::...:|:.|.::..|:.|..:.:..|.||:.:.:..:|        
Yeast   278 LYFCTVSLLTVGLGDILPKSVGAKIMVLIFSLSGVVLMGLIVFMTRSIIQKSSGPIFFFHRVEKG 342

  Fly   663 -SKALCCCLCSNCGYCCYDEKRMAEKER-RMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDA 725
             ||:....:.|:        |.::|:|. .:.:..:|...|||.                     
Yeast   343 RSKSWKHYMDSS--------KNLSEREAFDLMKCIRQTASRKQH--------------------- 378

  Fly   726 GAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLE 790
                                             ...||:...|.:.|.::      ||.|....|
Yeast   379 ---------------------------------WFSLSVTIAIFMAFWLL------GALVFKFAE 404

  Fly   791 KWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFC-----SVYIMSGM--TLTAMCFNV--- 845
            .|...:.|||||:.|.|||:||..|   |......:|.     :|.:|..:  |:..:.|::   
Yeast   405 NWSYFNCIYFCFLCLLTIGYGDYAP---RTGAGRAFFVIWALGAVPLMGAILSTVGDLLFDISTS 466

  Fly   846 ----IHEEIVHRIRIVVEFKKTSAANSGGGLIGGGSVSGGAGGAGGSMMDVAHEEGGQYYVPASX 906
                |.|...::::.:| |.....|.|  .::..|.:...:..|.|.:     ||.     ..| 
Yeast   467 LDIKIGESFNNKVKSIV-FNGRQRALS--FMVNTGEIFEESDTADGDL-----EEN-----TTSS 518

  Fly   907 HYEKRGHLYQRNPTE-ETLVTDTPTSL 932
            ...:.......|..| ::.||..|.||
Yeast   519 QSSQISEFNDNNSEENDSGVTSPPASL 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 16/49 (33%)
Ion_trans <601..640 CDD:278921 11/33 (33%)
Ion_trans_2 774..846 CDD:285168 23/85 (27%)
TOK1NP_012442.1 Ion_trans_2 253..328 CDD:400301 16/49 (33%)
Ion_trans_2 388..462 CDD:400301 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345206
Domainoid 1 1.000 56 1.000 Domainoid score I2685
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.