DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and KCNK16

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001128577.1 Gene:KCNK16 / 83795 HGNCID:14464 Length:322 Species:Homo sapiens


Alignment Length:232 Identity:58/232 - (25%)
Similarity:86/232 - (37%) Gaps:90/232 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   587 VGGVAVGGGP--PHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSS 649
            |.||...|..  |..|:|..:|.::.||:|||||||:||.|..|::..:.||..||||.:::|:.
Human    78 VKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNH 142

  Fly   650 TGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVR 714
            .|:.|                          ...:|..||...|.|:.:.|:             
Human   143 LGTGL--------------------------RAHLAAIERWEDRPRRSQVLQ------------- 168

  Fly   715 DVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYI 779
                                      |.||.                      :.|....::| :
Human   169 --------------------------VLGLA----------------------LFLTLGTLVI-L 184

  Fly   780 VFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLPG 816
            :|...|...:|.|...:|.||.|::||||||||.:.|
Human   185 IFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 25/56 (45%)
Ion_trans <601..640 CDD:278921 17/38 (45%)
Ion_trans_2 774..846 CDD:285168 18/43 (42%)
KCNK16NP_001128577.1 Ion_trans_2 <92..148 CDD:311712 25/81 (31%)
Ion_trans_2 180..>224 CDD:311712 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.