DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and KCO2

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_199449.1 Gene:KCO2 / 834680 AraportID:AT5G46370 Length:443 Species:Arabidopsis thaliana


Alignment Length:376 Identity:67/376 - (17%)
Similarity:117/376 - (31%) Gaps:146/376 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 DDVANAPSSSSSSSSSSSSSS-----------------------------SSTGASGVPGSNNPA 569
            |.::..||:|||:::|.|.|:                             :....:.:...|:|.
plant    71 DALSQNPSTSSSATTSFSDSTDLLLPLTEPNKPVRKSKPTINFHRSKTAPAMAAINNISHPNDPK 135

  Fly   570 T-----------EAVLLHTHYHHHRAGGVGGVAVGGGPPHEWNFAK------AFLYSLTVLTTIG 617
            |           :||.|...|...      ||.:.......:|..:      |..:.:..:.|||
plant   136 TDQQSDSKTIVNQAVALLVVYLSL------GVLIYWLNRDSYNVKQTHPVVDALYFCIVTMCTIG 194

  Fly   618 YGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCY--- 679
            ||::.|.:.:.::.::.:...|.....:.||                          |...|   
plant   195 YGDITPDSVVTKLFSIFFVLVGFGFMDILLS--------------------------GMVTYVLD 233

  Fly   680 -DEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGG 743
             .|..|.|..|     .:...|..:..|..   |:.||                           
plant   234 LQENYMLETAR-----NESLNLNDRDKVRS---YIIDV--------------------------- 263

  Fly   744 LGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPILDGIYFCFMSLSTI 808
                       .:|.|.   |...:.|...::::.:.||..:::.:||...||..||..||::|:
plant   264 -----------KKGRMR---IRLKVGLALGVVVLCLGFGVLIMHFVEKIGWLDSFYFSVMSVTTV 314

  Fly   809 GFGDMLPGLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEEIVHRIRIVVE 859
            |:||      |..|.         ::|..|.||...|....:...|..:.|
plant   315 GYGD------RAFNT---------LAGRLLAAMWLLVSTLAVARAILFLAE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 11/62 (18%)
Ion_trans <601..640 CDD:278921 8/44 (18%)
Ion_trans_2 774..846 CDD:285168 20/71 (28%)
KCO2NP_199449.1 Ion_trans_2 152..233 CDD:400301 17/112 (15%)
Ion_trans_2 280..350 CDD:400301 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.