DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and KCO5

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_192093.1 Gene:KCO5 / 828091 AraportID:AT4G01840 Length:408 Species:Arabidopsis thaliana


Alignment Length:253 Identity:44/253 - (17%)
Similarity:84/253 - (33%) Gaps:80/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   605 AFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCC 669
            |..:.:..:.|||||::||.|...:|..:.:..||.....:.||...:.:..:...:....:   
plant   153 ALYFCIVTMCTIGYGDIAPLTPWTKIFAVVFVLFGFGFLDILLSGVVNYVLDLQESMILTGI--- 214

  Fly   670 LCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNA 734
                                   :.||..:.........:.|.:                     
plant   215 -----------------------QTRQHHQHHHHHRFSAKDYII--------------------- 235

  Fly   735 GGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPILDGIY 799
                       |.:       :|.|.   |...:.|...::::.|..||.||:.:|:...:|.:|
plant   236 -----------DFE-------KGRMR---IRMKVCLALCVVVLCIGVGALVLHFVEELGFVDSVY 279

  Fly   800 FCFMSLSTIGFGD----MLPGLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEEIVHR 853
            ...||::|:|:||    .|.|        ..|.:|:::......|..|..:.|..:.|
plant   280 LSVMSVTTVGYGDRAFKTLQG--------RLFAAVWLLVSTLAVARAFLYLAEARIDR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 14/50 (28%)
Ion_trans <601..640 CDD:278921 11/34 (32%)
Ion_trans_2 774..846 CDD:285168 20/75 (27%)
KCO5NP_192093.1 Ion_trans_2 122..204 CDD:285168 14/50 (28%)
Ion_trans_2 254..325 CDD:285168 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.