DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and Kcnk16

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001102990.1 Gene:Kcnk16 / 688996 RGDID:1582911 Length:292 Species:Rattus norvegicus


Alignment Length:311 Identity:69/311 - (22%)
Similarity:109/311 - (35%) Gaps:116/311 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   587 VGGVAVGGGP--PHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSS 649
            |.||...|..  |..|:|..:|.::.||:|||||||:||.|..|::..:.||..||||.:|:|:.
  Rat    78 VKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALMGIPLNVVFLNH 142

  Fly   650 TGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVR 714
            .|:.|                                :.......|.::..|..|.         
  Rat   143 LGTGL--------------------------------RAHLTTLDRWEDHPRHSQL--------- 166

  Fly   715 DVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYI 779
                                                           |.:|...|......::.:
  Rat   167 -----------------------------------------------LQVLGLALFLTLGTLVIL 184

  Fly   780 VFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFCSVY-------IMSGMT 837
            :|.......:|.|...:|.||.|::||||||||.:.|    ::.:..:.:||       |:.|:.
  Rat   185 IFPPMFFSHVEGWSFREGFYFAFITLSTIGFGDYVVG----TDPSKHYIAVYRSLAAIWILLGLA 245

  Fly   838 LTAMCFNVIHEEIVHRIRIVVEFKKTSAANSGGGLIGGGSVSGGAGGAGGS 888
            ..|:..: :...::||...:.:            ||.|..|..||  |.||
  Rat   246 WLAVVLS-LGSLLLHRCSRLWQ------------LIRGLDVKDGA--APGS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 26/56 (46%)
Ion_trans <601..640 CDD:278921 17/38 (45%)
Ion_trans_2 774..846 CDD:285168 21/78 (27%)
Kcnk16NP_001102990.1 Ion_trans_2 <92..148 CDD:285168 26/87 (30%)
Ion_trans_2 180..248 CDD:285168 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9664
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.