DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and kcnk10a

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001305304.1 Gene:kcnk10a / 563228 ZFINID:ZDB-GENE-041210-291 Length:569 Species:Danio rerio


Alignment Length:250 Identity:57/250 - (22%)
Similarity:96/250 - (38%) Gaps:84/250 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSK 664
            |:...:|.::.||:|||||||:||.|..|:|..:.||.|||||....|:..|..|.    .:|.|
Zfish   169 WDLGSSFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGVGDQLG----TIFGK 229

  Fly   665 ALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGA 729
            ::                  |:.|:..|||..|                                
Zfish   230 SI------------------AKVEKMFRRKHNQ-------------------------------- 244

  Fly   730 PPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPI 794
                                :|.::.|       :.:.:|...:..|:::...|.:...:|.|..
Zfish   245 --------------------ISQTKIR-------VASTLLFILAGCILFVTIPAIIFKHIEGWTG 282

  Fly   795 LDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFCSV---YIMSGMTLTAMCFNVI 846
            |:.|||..::|:|:|.||.:.|..|......|:..:   :|:.|:...|...::|
Zfish   283 LEAIYFVVITLTTVGIGDYVAGGNRRIEYRKWYRPLVWFWILVGLAYFAAVLSMI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 26/55 (47%)
Ion_trans <601..640 CDD:278921 18/38 (47%)
Ion_trans_2 774..846 CDD:285168 19/74 (26%)
kcnk10aNP_001305304.1 Ion_trans_2 164..223 CDD:285168 25/53 (47%)
Ion_trans_2 263..342 CDD:285168 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9562
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.