DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and KCNK10

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_612190.1 Gene:KCNK10 / 54207 HGNCID:6273 Length:543 Species:Homo sapiens


Alignment Length:474 Identity:96/474 - (20%)
Similarity:160/474 - (33%) Gaps:190/474 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 TMAAAAAAVA-AQGTLAGSASAGGLNPFGQPASSGEFVYGLDGMDATDLEAGGMPQFALSPDTYD 480
            ::::.|..|| .:||     |.|||    |.....:.|..:..:....|..||:...||......
Human    49 SISSRATVVARMEGT-----SQGGL----QTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFES 104

  Fly   481 VRQRTIENIWDITVSLNILYKENWTKLAALEIAKF-QDQLIKRLNE-DVMLQ--LSHDDVANAPS 541
            .::.||                      |||.|:| :|.:.....| :.::|  |..|:...:|.
Human   105 SQKNTI----------------------ALEKAEFLRDHVCVSPQELETLIQHALDADNAGVSPI 147

  Fly   542 SSSSSSSSSSSSSSSTGASGVPGSNNPATEAVLLHTHYHHHRAGGVGGVAVGGGPPHEWNFAKAF 606
            .:||::||                                                 .|:...||
Human   148 GNSSNNSS-------------------------------------------------HWDLGSAF 163

  Fly   607 LYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLC 671
            .::.||:|||||||:||.|..|:|..:.||.|||||....|:..|..|.    .:|.|::.    
Human   164 FFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLG----TIFGKSIA---- 220

  Fly   672 SNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGG 736
                                   |.::..||:|.                               
Human   221 -----------------------RVEKVFRKKQV------------------------------- 231

  Fly   737 PVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPILDGIYFC 801
                                 |...:.:::.||...:..|:::...|.:...:|.|..|:.|||.
Human   232 ---------------------SQTKIRVISTILFILAGCIVFVTIPAVIFKYIEGWTALESIYFV 275

  Fly   802 FMSLSTIGFGDMLPGLRRESNATTWFCSV---YIMSGMTLTAMCFNVI-----------HEEI-- 850
            .::|:|:||||.:.|.....|...|:..:   :|:.|:...|...::|           .||:  
Human   276 VVTLTTVGFGDFVAGGNAGINYREWYKPLVWFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGE 340

  Fly   851 --VH----RIRIVVEFKKT 863
              .|    :..:..||::|
Human   341 IKAHAAEWKANVTAEFRET 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 27/56 (48%)
Ion_trans <601..640 CDD:278921 19/38 (50%)
Ion_trans_2 774..846 CDD:285168 20/74 (27%)
KCNK10NP_612190.1 Ion_trans_2 153..211 CDD:285168 28/106 (26%)
Ion_trans_2 249..328 CDD:285168 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.