DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and kcnk6

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001025245.2 Gene:kcnk6 / 504083 ZFINID:ZDB-GENE-050309-213 Length:315 Species:Danio rerio


Alignment Length:252 Identity:49/252 - (19%)
Similarity:94/252 - (37%) Gaps:87/252 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSK 664
            |:.|.:..::.|::||:|||:..|.:..|:..::.||..|:|.|::.|:   :.:.|:...:..:
Zfish    89 WDLASSLFFANTMVTTVGYGHTTPLSDAGKAFSIVYALIGVPFTMLVLT---ACVQRLMHPLTYR 150

  Fly   665 ALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGA 729
            .:..|                                :::|.:|:                    
Zfish   151 PISAC--------------------------------QRRAGLQQ-------------------- 163

  Fly   730 PPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPI 794
                                    .|...:|.:.:|..::||| .::..:||.|..    |.|..
Zfish   164 ------------------------RSASVVHFIVLLFLVVLCF-FVVPSLVFSAIE----ETWSF 199

  Fly   795 LDGIYFCFMSLSTIGFGDMLPGLRRESNATTWF---CSVYIMSGMTLTAMCFNVIHE 848
            ||..||||:||.|||.||.:|..:...:....:   ..||:..|:.:..:.....|:
Zfish   200 LDAFYFCFISLCTIGLGDFVPAEKPGQSLRALYKISVMVYLFVGLMVMFLVLRTFHK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 16/55 (29%)
Ion_trans <601..640 CDD:278921 11/38 (29%)
Ion_trans_2 774..846 CDD:285168 22/74 (30%)
kcnk6NP_001025245.2 Ion_trans_2 84..145 CDD:285168 17/58 (29%)
Ion_trans_2 178..254 CDD:285168 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.