DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and Kcnk18

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001003820.1 Gene:Kcnk18 / 445371 RGDID:1303091 Length:405 Species:Rattus norvegicus


Alignment Length:317 Identity:78/317 - (24%)
Similarity:128/317 - (40%) Gaps:94/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 PHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREV 661
            |.:|:|..|..:..||.:|:|||::.|.|.||:.:.:.||.|||||..:.|:..|.|||.:....
  Rat   120 PEDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILAAILSRA 184

  Fly   662 FSK--ALCC-----------CLCSNCGYCCYDEKRMAEK-------------------------- 687
            :|:  ||.|           .||..     ..:.:.|::                          
  Rat   185 YSRFQALLCLPRDISKWRPLLLCRK-----QTDSKPADEAIPQIVIDAGADELLDPQPSREPASP 244

  Fly   688 -------ERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLG 745
                   ||.:.|::|.|        :|.|....:..::.||...|.           .|...|.
  Rat   245 SCNVELFERLVAREKQNE--------LQPPMRPVERSNSCPELVLGR-----------LSCSILS 290

  Fly   746 DIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWP----ILDGIYFCFMSLS 806
            ::|.:.....|     |.|..|::..  ::..||...||:   |..|.    ..|..||||::|:
  Rat   291 NLDEVGQQVER-----LDIPLPVIAL--VIFAYISCAAAI---LPFWETDLGFEDAFYFCFVTLT 345

  Fly   807 TIGFGDML---PGLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEEIVHRIRIVVEF 860
            ||||||::   |..       ..|.|:||:.||.:..:.|.::...::|..:.::.|
  Rat   346 TIGFGDIVLVHPHF-------FLFFSIYIIVGMEILFIAFKLMQNRLLHTYKTLMLF 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 24/56 (43%)
Ion_trans <601..640 CDD:278921 15/38 (39%)
Ion_trans_2 774..846 CDD:285168 26/78 (33%)
Kcnk18NP_001003820.1 Ion_trans_2 116..177 CDD:285168 23/56 (41%)
Interaction with calcineurin. /evidence=ECO:0000250 221..226 0/4 (0%)
Interaction with YWHAH. /evidence=ECO:0000250 272..277 0/4 (0%)
Ion_trans_2 311..387 CDD:285168 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45429
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.