DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and Task7

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster


Alignment Length:368 Identity:82/368 - (22%)
Similarity:119/368 - (32%) Gaps:130/368 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 PH----EWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARV 657
            ||    :|.||.||.:|..||..||||:..|.|..|:...:.||..||||.||...|.|..|.:.
  Fly    72 PHKAGPQWKFAGAFYFSTVVLAMIGYGHSTPVTIPGKAFCMGYAMVGIPLGLVMFQSIGERLNKF 136

  Fly   658 AREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPE 722
            |..:..:|.     ...|..|.|...|                                      
  Fly   137 ASVIIRRAK-----RASGARCTDATEM-------------------------------------- 158

  Fly   723 KDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMM-IIYIVFGAAVL 786
                                                        .::|...|: .|.|..||||.
  Fly   159 --------------------------------------------NLMLATGMLSSIIITTGAAVF 179

  Fly   787 YRLEKWPILDGIYFCFMSLSTIGFGDMLPGLRRESNAT-----TWFCSVYIMSGMTLTAMCFNVI 846
            .|.|.|...|..|:||::|:||||||.: .|:.:...|     .....|:|:.|:.:.|...|: 
  Fly   180 SRYEGWSYFDSFYYCFVTLTTIGFGDYV-ALQNDQALTNKPGYVALSLVFILFGLAVVAASINL- 242

  Fly   847 HEEIVHRIRIVVEFKKTSAANSGGGLIGGGSVSGGAGGAGGSMMDVAHEEGGQYYVPASXHYEKR 911
                     :|:.|....|.::...       ...|....|:...|..::        . .|...
  Fly   243 ---------LVLRFMTMQAEDAKRD-------EQDAQNLAGNAQPVTFDD--------ESTYNMH 283

  Fly   912 GHLYQRNPT---EETLVTDTPTSLVLKDYVNHELVPILTMDPN 951
            |.|.:.|.|   :||....:.|.:.....:|||..    :||:
  Fly   284 GKLLENNYTTENDETASLCSCTCMGGTRCLNHEQF----VDPD 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 26/56 (46%)
Ion_trans <601..640 CDD:278921 16/38 (42%)
Ion_trans_2 774..846 CDD:285168 28/77 (36%)
Task7NP_649891.1 Ion_trans_2 <78..133 CDD:285168 25/54 (46%)
Ion_trans_2 166..248 CDD:285168 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.