DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and kcnk5b

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_956927.1 Gene:kcnk5b / 393606 ZFINID:ZDB-GENE-040426-1297 Length:448 Species:Danio rerio


Alignment Length:297 Identity:66/297 - (22%)
Similarity:106/297 - (35%) Gaps:108/297 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   598 HEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVF 662
            :.||:..|.:::.||:||||||||||:||.||:..:.|...||||.|.::|..|:...       
Zfish    81 NNWNWENAVIFAATVITTIGYGNVAPKTTGGRLFCILYGLCGIPLCLTWISELGTFFG------- 138

  Fly   663 SKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGA 727
                                        .|.|      |..|.::.....||.|           
Zfish   139 ----------------------------SRTK------RLSQLLLHSGLNVRKV----------- 158

  Fly   728 GAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKW 792
                                               ..:..|:......:::::..|.|....|.|
Zfish   159 -----------------------------------QFICTIVFLLWGFLVHLIIPAFVFMFFENW 188

  Fly   793 PILDGIYFCFMSLSTIGFGDMLPGLRRESNATT---WFCSVYIMSGMTLTAMCFN---------- 844
            ..|:|:||.|.:|:|:||||.:.|:....|..|   :|..::|..|:...::.|:          
Zfish   189 TYLEGLYFSFTTLTTVGFGDYVAGVDPSVNYPTLYRFFVQLWIYLGLAWLSLFFSWNVHMVVEAH 253

  Fly   845 -VIHEEIVHRIRIVV-------EFKKTSAANSGGGLI 873
             |:.:..:.|.|:..       |.|||.......|:|
Zfish   254 KVLKKRRMRRHRLPTDDVPEKKEVKKTPKPPPRSGVI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 27/56 (48%)
Ion_trans <601..640 CDD:278921 19/38 (50%)
Ion_trans_2 774..846 CDD:285168 22/85 (26%)
kcnk5bNP_956927.1 Ion_trans_2 <81..137 CDD:285168 27/55 (49%)
Ion_trans <142..234 CDD:278921 27/143 (19%)
Ion_trans_2 171..243 CDD:285168 21/71 (30%)
C_Hendra 258..>323 CDD:293426 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.