DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and KCNK18

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_862823.1 Gene:KCNK18 / 338567 HGNCID:19439 Length:384 Species:Homo sapiens


Alignment Length:295 Identity:72/295 - (24%)
Similarity:120/295 - (40%) Gaps:57/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAR----- 659
            |:|..:..:..||.:|:|||.:.|.|.||:.:.:.||.|||||..:.|:.||.|||.:..     
Human   101 WSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNR 165

  Fly   660 ----EVFSKALCCCLCSNCGYCCYDEKRMAEK------------------------ERRMRRKRQ 696
                ..|::.|....|....:....:.:.|::                        ...|....:
Human   166 FRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFER 230

  Fly   697 QEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHG 761
            ...|.||. .:|.|....:..::.||...|.           .|...:.::|.:.....|     
Human   231 SHALEKQN-TLQLPPQAMERSNSCPELVLGR-----------LSYSIISNLDEVGQQVER----- 278

  Fly   762 LSILAPILLCFSMMIIYIVFGAAVLYRLE-KWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATT 825
            |.|..||:..  ::..||...||:|...| :....:..||||::|:||||||.:    .|.....
Human   279 LDIPLPIIAL--IVFAYISCAAAILPFWETQLDFENAFYFCFVTLTTIGFGDTV----LEHPNFF 337

  Fly   826 WFCSVYIMSGMTLTAMCFNVIHEEIVHRIRIVVEF 860
            .|.|:||:.||.:..:.|.::...::...:.|:.|
Human   338 LFFSIYIIVGMEIVFIAFKLVQNRLIDIYKNVMLF 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 24/55 (44%)
Ion_trans <601..640 CDD:278921 14/38 (37%)
Ion_trans_2 774..846 CDD:285168 25/72 (35%)
KCNK18NP_862823.1 Ion_trans_2 <100..155 CDD:285168 22/53 (42%)
Interaction with calcineurin. /evidence=ECO:0000250 200..205 0/4 (0%)
Interaction with YWHAH. /evidence=ECO:0000250 249..254 0/4 (0%)
Ion_trans_2 288..364 CDD:285168 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.