DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and CG43155

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster


Alignment Length:456 Identity:98/456 - (21%)
Similarity:154/456 - (33%) Gaps:178/456 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 RHADNDTMAAAAAAVAAQGTLAGSASA---------GGLNPFGQPASSGEFVY-GLDGMDATDLE 465
            :|.|....||....: |:||..|..|.         ..||..|...|..  :| |:.|:....||
  Fly    26 KHLDRRVDAAEGGGL-AKGTAGGRRSTACWQSMKWKSALNHIGLLVSLS--IYCGVGGLIFRHLE 87

  Fly   466 -AGGMPQFALSPDTYDV-RQRTIENIWDITVSLNILYKENWTKLAALEIAKFQDQLIKRLNEDVM 528
             ...:.:.:...|.... |:|.:..|      ||.....|..:|.:.|:||: :..:::..|..:
  Fly    88 RPAEVERLSHLKDIVKTHRERFLHTI------LNNTEVHNLDELLSFELAKY-EAAVQQAAEGGL 145

  Fly   529 LQLSHDDVANAPSSSSSSSSSSSSSSSSTGASGVPGSNNPATEAVLLHTHYHHHRAGGVGGVAVG 593
            |.::..|...                                                       
  Fly   146 LIVADKDFPE------------------------------------------------------- 155

  Fly   594 GGPPHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVA 658
              |...|:..:|..:|.||||||||||:.|.||.||:..:.:|..|||.||..::..|.:.| .|
  Fly   156 --PYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFA-TA 217

  Fly   659 REVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDV----FHA 719
            ..||.                  |.|..|                      |.:...:    |:|
  Fly   218 VSVFG------------------KHMPTK----------------------PKFTNFIGKTWFYA 242

  Fly   720 TPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAA 784
                              :.:||.||                               :|:..||.
  Fly   243 ------------------ILAVGFLG-------------------------------VYLAAGAG 258

  Fly   785 VLYRLE-KWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFCSVYIMSGMTLTAMCFNVIHE 848
            :|...| .|...||.||||::::||||||::|   ::.|... .|::||:.|:.||:....::..
  Fly   259 LLLLWEDDWTFFDGFYFCFITMTTIGFGDLVP---KKPNYML-LCTLYILIGLALTSTIIELVRR 319

  Fly   849 E 849
            :
  Fly   320 Q 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 25/56 (45%)
Ion_trans <601..640 CDD:278921 18/38 (47%)
Ion_trans_2 774..846 CDD:285168 26/72 (36%)
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 25/56 (45%)
Ion_trans <240..314 CDD:278921 32/126 (25%)
Ion_trans_2 <266..319 CDD:285168 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461288
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.