DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-32

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_506416.2 Gene:twk-32 / 192075 WormBaseID:WBGene00006684 Length:614 Species:Caenorhabditis elegans


Alignment Length:270 Identity:69/270 - (25%)
Similarity:111/270 - (41%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   598 HEW-----------NFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTG 651
            |.|           ||.....::.|.||:||||..||.:.:||:..|.|.||||||.|:.::.  
 Worm   111 HRWQEAAFNANPLTNFTSNLFFAATTLTSIGYGIDAPESLIGRVFCLVYLFFGIPLYLITIAD-- 173

  Fly   652 SILARVAREVFSKALCCCLCSNCGYCCYDE--KRMAEKERRMRRKRQQEELRKQQAVMQEPYYVR 714
              :|:...|:.::.             |.|  |.....:||.:|.:.....|:...|        
 Worm   174 --MAKFCTELMNRT-------------YTEIIKYKYRVKRRYKRWKSGRIRRESMKV-------- 215

  Fly   715 DVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYI 779
                                 |.|...||..::.....:...   |...:..|.||...::::||
 Worm   216 ---------------------GQVIIAGGEDEVAEFLWTHLE---HAQFVEVPFLLVIGILLLYI 256

  Fly   780 VFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFCSVYIMSGMTLTAMCFN 844
            ...:.::..:|.|.::||.||..||:.||||||::|  |.|..|..  ....|::|:.||..|.:
 Worm   257 GLSSWIISWVENWNMMDGFYFVMMSVLTIGFGDLVP--RNEIFAVP--ILFIILAGLVLTTTCID 317

  Fly   845 VIHEEIVHRI 854
            |:....:.|:
 Worm   318 VVGAYYIDRL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 23/67 (34%)
Ion_trans <601..640 CDD:278921 17/38 (45%)
Ion_trans_2 774..846 CDD:285168 25/71 (35%)
twk-32NP_506416.2 Ion_trans_2 <125..180 CDD:285168 23/58 (40%)
Ion_trans_2 251..325 CDD:285168 26/77 (34%)
FN3 392..485 CDD:238020
FN3 491..580 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.