DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-1

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001293466.1 Gene:twk-1 / 192072 WormBaseID:WBGene00006656 Length:451 Species:Caenorhabditis elegans


Alignment Length:257 Identity:50/257 - (19%)
Similarity:92/257 - (35%) Gaps:98/257 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   598 HEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVF 662
            :|.:|....|:.:|.::||||||:||....|:::.:.|...||||..:.: :|.|:|.       
 Worm    98 NEASFLDRALFCITTISTIGYGNIAPFDDRGKVICILYCVAGIPLFFMTV-ATNSVLV------- 154

  Fly   663 SKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGA 727
                 ..:|:                                 ::...|..::|           
 Worm   155 -----VDICN---------------------------------IVHRSYSSQNV----------- 170

  Fly   728 GAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKW 792
                                      |:.|.....|.:.....||...:|:.::       :::.
 Worm   171 --------------------------ENSGFRWYTSAILLAAHCFIGALIFSLW-------IDQL 202

  Fly   793 PILDGIYFCFMSLSTIGFGDMLP---GLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEEIV 851
            ..||..||.|:|::|||:||..|   ||.:....|     ||:.:|:....:.|..:.:.|:
 Worm   203 DFLDAFYFSFISITTIGYGDYSPTPEGLFQYIIVT-----VYLCTGVATMLLFFASLQKGIM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 21/56 (38%)
Ion_trans <601..640 CDD:278921 13/38 (34%)
Ion_trans_2 774..846 CDD:285168 20/74 (27%)
twk-1NP_001293466.1 Ion_trans_2 76..156 CDD:285168 21/70 (30%)
Ion_trans_2 182..260 CDD:285168 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.