DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-1

DIOPT Version :10

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001293466.1 Gene:twk-1 / 192072 WormBaseID:WBGene00006656 Length:451 Species:Caenorhabditis elegans


Alignment Length:257 Identity:50/257 - (19%)
Similarity:92/257 - (35%) Gaps:98/257 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   598 HEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVF 662
            :|.:|....|:.:|.::||||||:||....|:::.:.|...||||..:.: :|.|:|.       
 Worm    98 NEASFLDRALFCITTISTIGYGNIAPFDDRGKVICILYCVAGIPLFFMTV-ATNSVLV------- 154

  Fly   663 SKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGA 727
                 ..:|:                                 ::...|..::|           
 Worm   155 -----VDICN---------------------------------IVHRSYSSQNV----------- 170

  Fly   728 GAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKW 792
                                      |:.|.....|.:.....||...:|:.::       :::.
 Worm   171 --------------------------ENSGFRWYTSAILLAAHCFIGALIFSLW-------IDQL 202

  Fly   793 PILDGIYFCFMSLSTIGFGDMLP---GLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEEIV 851
            ..||..||.|:|::|||:||..|   ||.:....|     ||:.:|:....:.|..:.:.|:
 Worm   203 DFLDAFYFSFISITTIGYGDYSPTPEGLFQYIIVT-----VYLCTGVATMLLFFASLQKGIM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:462301 21/56 (38%)
Ion_trans_2 774..846 CDD:462301 20/74 (27%)
twk-1NP_001293466.1 Ion_trans_2 76..149 CDD:462301 18/51 (35%)
Ion_trans_2 182..256 CDD:462301 22/85 (26%)

Return to query results.
Submit another query.