DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-23

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001257229.1 Gene:twk-23 / 192071 WormBaseID:WBGene00006676 Length:443 Species:Caenorhabditis elegans


Alignment Length:291 Identity:74/291 - (25%)
Similarity:108/291 - (37%) Gaps:99/291 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 PHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREV 661
            |..|.|..:.|:|.|:|||||||||.|.|...::..:.|..|||||.|:.::..|.         
 Worm   134 PKRWTFPSSVLFSFTILTTIGYGNVTPHTQQCKVFLMIYGAFGIPLFLITIADLGR--------- 189

  Fly   662 FSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAG 726
            |||.....|.                     :|..:.||:||                       
 Worm   190 FSKTAIMALV---------------------QKVSKRELKKQ----------------------- 210

  Fly   727 AGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLE- 790
                                          ...|.|..:|.:||...:.:::|..|:||:...| 
 Worm   211 ------------------------------SDEHLLREIAEVLLVAGLFVVFIAIGSAVIPLWEN 245

  Fly   791 KWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFCSVYIMSGMTLT-------AMCFNVIHE 848
            :....|.:||.:|||:|||.||::| .|.:....|   .:||..|:.||       |..|.::| 
 Worm   246 QLTYFDSVYFSYMSLTTIGLGDIVP-RRMDFLLPT---LIYITIGLWLTTALVEQLADVFRLVH- 305

  Fly   849 EIVHRIRIVVEFKKTSAANSGGGLIGGGSVS 879
               :..|.|...|..:....|..|..||.:|
 Worm   306 ---YAGRQVTNVKGITVWLGGRRLSMGGLIS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 24/56 (43%)
Ion_trans <601..640 CDD:278921 17/38 (45%)
Ion_trans_2 774..846 CDD:285168 26/79 (33%)
twk-23NP_001257229.1 Ion_trans_2 118..190 CDD:285168 25/64 (39%)
Ion_trans_2 228..302 CDD:285168 25/77 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.