DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-45

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001122742.2 Gene:twk-45 / 190614 WormBaseID:WBGene00006695 Length:508 Species:Caenorhabditis elegans


Alignment Length:319 Identity:63/319 - (19%)
Similarity:104/319 - (32%) Gaps:131/319 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 ATEAVLLHTHYHHHRAGGVGGVAVGGGPPHE---------WNFAKAFLYSLTVLTTIGYGNVAPR 624
            |...:||.|....|           |...|:         |.|:.|..||:|:.:|||||.:..:
 Worm   156 AYHRILLETEGKFH-----------GSAWHKSENLDMNLMWYFSSATFYSMTLFSTIGYGTITCQ 209

  Fly   625 TTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKER 689
            |..|:.|::.||..|:|:.|:.|...|....:|....:...:.                   |.:
 Worm   210 TFWGKTVSMVYASIGLPIMLLVLGDIGVWFQKVMTNAYIFVML-------------------KYK 255

  Fly   690 RMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASE 754
            .:|  :|..|:::::.                                                 
 Worm   256 SLR--KQSIEIKRKET------------------------------------------------- 269

  Fly   755 SRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEK-------WPILDGIYFCFMSLSTIGFGD 812
                      |.|:.|...::..||:.....:...:.       ....|..||.|:||:|||.||
 Worm   270 ----------LLPMWLAMLVVFTYIIICTLTILLFDDNEGDEPGINFFDAFYFTFISLTTIGLGD 324

  Fly   813 MLP---------------GLRRESNATTWFCSVYIMSGMTLTAMCFNVIH--EEIVHRI 854
            ::|               ||...|...|   |:|    .||....:|:|:  |:.:.||
 Worm   325 VMPYNIQYSPFLPLAFLLGLALISIVNT---SIY----STLYQSFYNLIYSLEDQLDRI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 21/65 (32%)
Ion_trans <601..640 CDD:278921 15/38 (39%)
Ion_trans_2 774..846 CDD:285168 23/93 (25%)
twk-45NP_001122742.2 Ion_trans_2 <185..241 CDD:285168 21/55 (38%)
Ion_trans_2 278..354 CDD:285168 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163749
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.