powered by:
Protein Alignment CG42594 and twk-49
DIOPT Version :9
Sequence 1: | NP_001162668.2 |
Gene: | CG42594 / 8674091 |
FlyBaseID: | FBgn0260971 |
Length: | 1039 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001022268.1 |
Gene: | twk-49 / 187626 |
WormBaseID: | WBGene00019904 |
Length: | 337 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 20/57 - (35%) |
Similarity: | 31/57 - (54%) |
Gaps: | 5/57 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 596 PP--HEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPL---TLVYL 647
|| .||::..:|.::.::|.|||.|...|.|...:|..:.|...|||| ||:.:
Worm 138 PPSRREWSWISSFNFAYSLLLTIGGGFKVPATVGSQIFAVFYCLIGIPLFYSTLILI 194
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11003 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.