DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-37

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_491810.2 Gene:twk-37 / 183583 WormBaseID:WBGene00006689 Length:382 Species:Caenorhabditis elegans


Alignment Length:291 Identity:63/291 - (21%)
Similarity:106/291 - (36%) Gaps:100/291 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 PPHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAR- 659
            |.|...|.....|.:|.:||||||.:...|..|::||:||...||.|||..|.:.|.|..::.. 
 Worm   175 PKHIEEFLDGLAYVITCITTIGYGELVCHTIAGKLVTVAYGIIGIALTLYVLRNNGKITLKICNL 239

  Fly   660 --EVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPE 722
              ::|  |:|   ...||      |:.|:.:                                  
 Worm   240 TLKIF--AIC---VRKCG------KKSAKYK---------------------------------- 259

  Fly   723 KDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLY 787
                                                       ..:|..|.:::.:..|||..:.
 Worm   260 -------------------------------------------MTVLKAFILLVTFWGFGALAIA 281

  Fly   788 RLEKWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEEIVH 852
            ..|::...|.:||.|.:.|||||||.:|.   ...:.|..|.::.:. ::|.:|...::|..:.:
 Worm   282 VYEEFVFYDALYFSFSTFSTIGFGDFVPS---GHISGTIICVLHFID-LSLISMVLVLVHHSMEN 342

  Fly   853 RIRIVVE-FKKTSAANSGGGLIGGGSVSGGA 882
            |...|:| |.:..|.::    :....:|.||
 Worm   343 RFMRVLELFDERHATDT----LETNMISPGA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 23/56 (41%)
Ion_trans <601..640 CDD:278921 15/38 (39%)
Ion_trans_2 774..846 CDD:285168 20/71 (28%)
twk-37NP_491810.2 Ion_trans_2 <181..235 CDD:285168 23/53 (43%)
Ion_trans_2 267..336 CDD:285168 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.