DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-18

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001379714.1 Gene:twk-18 / 181139 WormBaseID:WBGene00006672 Length:461 Species:Caenorhabditis elegans


Alignment Length:251 Identity:67/251 - (26%)
Similarity:105/251 - (41%) Gaps:59/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSK 664
            |.|..:..|.:||.|||||||:.|.|..||..|:.|||.|||||::.|...||:.|:..:.::  
 Worm   114 WTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLW-- 176

  Fly   665 ALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGA 729
                              |...|..|:..|....::.:                |....:.|..|
 Worm   177 ------------------RFFLKSTRVVSKDLSNKISE----------------AADNIEEGTTA 207

  Fly   730 PPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPI 794
            ..|:|.....:     |.|.||...|     ||.::.         :|:::|.|.:...||:|..
 Worm   208 ITPSAEKTENN-----DDDLLSFPIS-----GLLLIT---------VIWVIFCAVLFTFLEEWDF 253

  Fly   795 LDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEEI 850
            ...:||..:|.:||||||:||    ..........|.::.|::|.:....:|.::|
 Worm   254 GTSLYFTLISFTTIGFGDILP----SDYDFMPIVGVLLLIGLSLVSTVMTLIQQQI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 28/55 (51%)
Ion_trans <601..640 CDD:278921 19/38 (50%)
Ion_trans_2 774..846 CDD:285168 20/71 (28%)
twk-18NP_001379714.1 Ion_trans_2 <114..170 CDD:400301 28/55 (51%)
Ion_trans_2 232..306 CDD:400301 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.