DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-46

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_741678.1 Gene:twk-46 / 180252 WormBaseID:WBGene00006696 Length:319 Species:Caenorhabditis elegans


Alignment Length:270 Identity:60/270 - (22%)
Similarity:102/270 - (37%) Gaps:98/270 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSK 664
            |.|.:||.::.|:::|:|||.|:|||..|::.|:.|...||||||..||   :|:|         
 Worm   108 WTFGQAFFFAGTLISTVGYGRVSPRTEYGKLFTILYCVIGIPLTLALLS---AIVA--------- 160

  Fly   665 ALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGA 729
                              ||.|...::|....|.                               
 Worm   161 ------------------RMREPSHKLRGLLNQR------------------------------- 176

  Fly   730 PPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYI-VFGAAVLYRLE-KW 792
                       :|.|..::.:.             |..:.:.|:.::::: ...|.|...:| .|
 Worm   177 -----------LGHLFTVNHIQ-------------LIHVGVVFASLLLFVFAIPAWVFSSIETDW 217

  Fly   793 PILDGIYFCFMSLSTIGFGDMLPGLRRESNATTWF---CSVYIMSGMTLTAMCFNVIHEEIVHRI 854
            ..||..|:||:||:|||.||..||.....:....:   .:||:|.|:....:....:::      
 Worm   218 SYLDAFYYCFVSLTTIGLGDFEPGDDPNQSFRGLYKIGATVYLMGGLCCMMLFLATLYD------ 276

  Fly   855 RIVVEFKKTS 864
              :.:|..||
 Worm   277 --IPQFNLTS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 25/55 (45%)
Ion_trans <601..640 CDD:278921 15/38 (39%)
Ion_trans_2 774..846 CDD:285168 22/76 (29%)
twk-46NP_741678.1 Ion_trans_2 <107..164 CDD:285168 28/85 (33%)
Ion_trans_2 198..274 CDD:285168 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.