DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-5

DIOPT Version :10

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001021896.1 Gene:twk-5 / 174756 WormBaseID:WBGene00006660 Length:281 Species:Caenorhabditis elegans


Alignment Length:254 Identity:54/254 - (21%)
Similarity:87/254 - (34%) Gaps:100/254 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 EWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVARE--- 660
            |.:|.:...:....::||||||..|:|...|:.::.::..||||.:|.|.:.|..|.:...:   
 Worm    44 EQSFYEVVFFEFITISTIGYGNQYPQTHASRVFSIFFSILGIPLLVVTLGNFGKYLTKFYWKTHG 108

  Fly   661 -VFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKD 724
             :||                              :|.:.||            |.|       ||
 Worm   109 WIFS------------------------------ERTESEL------------VND-------KD 124

  Fly   725 AGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRL 789
                                              |.|:.|....||.|::...:|....|..   
 Worm   125 ----------------------------------MPGIVIACLYLLTFAIGFFFIPHSGAAY--- 152

  Fly   790 EKWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFCSV--YIMSGMTLTAMCFNVI 846
                .:|..||.|:|.:|:||||.:|    :.:....||.|  |::.|..|..|..:.:
 Worm   153 ----SIDDCYFSFISFATVGFGDKVP----QIDTFEKFCKVITYLVWGTILNIMLISYV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:462301 19/56 (34%)
Ion_trans_2 774..846 CDD:462301 20/73 (27%)
twk-5NP_001021896.1 Ion_trans_2 22..101 CDD:462301 19/56 (34%)
Ion_trans_2 130..209 CDD:462301 24/85 (28%)

Return to query results.
Submit another query.