DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and twk-5

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001021896.1 Gene:twk-5 / 174756 WormBaseID:WBGene00006660 Length:281 Species:Caenorhabditis elegans


Alignment Length:254 Identity:54/254 - (21%)
Similarity:87/254 - (34%) Gaps:100/254 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 EWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVARE--- 660
            |.:|.:...:....::||||||..|:|...|:.::.::..||||.:|.|.:.|..|.:...:   
 Worm    44 EQSFYEVVFFEFITISTIGYGNQYPQTHASRVFSIFFSILGIPLLVVTLGNFGKYLTKFYWKTHG 108

  Fly   661 -VFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKD 724
             :||                              :|.:.||            |.|       ||
 Worm   109 WIFS------------------------------ERTESEL------------VND-------KD 124

  Fly   725 AGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRL 789
                                              |.|:.|....||.|::...:|....|..   
 Worm   125 ----------------------------------MPGIVIACLYLLTFAIGFFFIPHSGAAY--- 152

  Fly   790 EKWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFCSV--YIMSGMTLTAMCFNVI 846
                .:|..||.|:|.:|:||||.:|    :.:....||.|  |::.|..|..|..:.:
 Worm   153 ----SIDDCYFSFISFATVGFGDKVP----QIDTFEKFCKVITYLVWGTILNIMLISYV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 19/56 (34%)
Ion_trans <601..640 CDD:278921 10/38 (26%)
Ion_trans_2 774..846 CDD:285168 20/73 (27%)
twk-5NP_001021896.1 Ion_trans_2 22..101 CDD:285168 19/56 (34%)
Ion_trans_2 135..209 CDD:285168 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.