DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and sup-9

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_494333.1 Gene:sup-9 / 173613 WormBaseID:WBGene00006318 Length:329 Species:Caenorhabditis elegans


Alignment Length:352 Identity:73/352 - (20%)
Similarity:122/352 - (34%) Gaps:152/352 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   509 ALEIAK--FQDQLIKRLNEDVMLQLSHDDVANAPSSSSSSSSSSSSSSSSTGASGVPGSNNPATE 571
            |||...  .|.:|::|:.|.:             .:..:.|::......:|....||        
 Worm    28 ALETENEILQRKLVQRVREKL-------------KTKYNMSNADYEILEATIVKSVP-------- 71

  Fly   572 AVLLHTHYHHHRAGGVGGVAVGGGPPHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYA 636
                      |:||            ::|.|:.||.::.||:||||||:..|.|..|::..:.||
 Worm    72 ----------HKAG------------YQWKFSGAFYFATTVITTIGYGHSTPMTDAGKVFCMLYA 114

  Fly   637 FFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELR 701
            ..||||.|:...|.|..:...|.::.                          |.:||        
 Worm   115 LAGIPLGLIMFQSIGERMNTFAAKLL--------------------------RFIRR-------- 145

  Fly   702 KQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILA 766
                                    .||..|                                   
 Worm   146 ------------------------AAGKQP----------------------------------- 151

  Fly   767 PILLCFSMMIIY-------IVFGAAVLY-RLEKWPILDGIYFCFMSLSTIGFGDMLPGLRRESNA 823
              ::..|.:||:       ::||.|.:: ..|.|...|.:|:||::|:||||||.:...:|.|..
 Worm   152 --IVTSSDLIIFCTGWGGLLIFGGAFMFSSYENWTYFDAVYYCFVTLTTIGFGDYVALQKRGSLQ 214

  Fly   824 T----TWFCSVYIMSGMTLTAMCFNVI 846
            |    .:|..|:|:.|:|:.:...|::
 Worm   215 TQPEYVFFSLVFILFGLTVISAAMNLL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 24/56 (43%)
Ion_trans <601..640 CDD:278921 16/38 (42%)
Ion_trans_2 774..846 CDD:285168 27/83 (33%)
sup-9NP_494333.1 Ion_trans_2 <77..132 CDD:311712 24/54 (44%)
Ion_trans_2 168..242 CDD:311712 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.