DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and Kcnk2

DIOPT Version :10

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_742039.1 Gene:Kcnk2 / 170899 RGDID:621448 Length:426 Species:Rattus norvegicus


Alignment Length:291 Identity:62/291 - (21%)
Similarity:102/291 - (35%) Gaps:116/291 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSK 664
            |:...:|.::.||:||||:||::|||..|:|..:.||..||||....|:..|..|.    .:|.|
  Rat   142 WDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLG----TIFGK 202

  Fly   665 ALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGA 729
            .:.                                            .|.|.|            
  Rat   203 GIA--------------------------------------------KVEDTF------------ 211

  Fly   730 PPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPI 794
                              ...:.|:::     :.|::.|:......::::...|.:...:|.|..
  Rat   212 ------------------IKWNVSQTK-----IRIISTIIFILFGCVLFVALPAVIFKHIEGWSA 253

  Fly   795 LDGIYFCFMSLSTIGFGDMLPGLRRESN--------ATTWFCSVYIMSGMTLTAMCFNVIHE--- 848
            ||.|||..::|:||||||.:.|   .|:        ...||   :|:.|:...|...::|.:   
  Rat   254 LDAIYFVVITLTTIGFGDYVAG---GSDIEYLDFYKPVVWF---WILVGLAYFAAVLSMIGDWLR 312

  Fly   849 -------EIVHRIR---------IVVEFKKT 863
                   |.|...|         :..|||:|
  Rat   313 VISKKTKEEVGEFRAHAAEWTANVTAEFKET 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:462301 24/55 (44%)
Ion_trans_2 774..846 CDD:462301 22/79 (28%)
Kcnk2NP_742039.1 Important for GNG4 binding and L-glutamate release in astrocytes. /evidence=ECO:0000269|PubMed:23021213 17..38
Important for GNG4 binding and L-glutamate release in astrocytes. /evidence=ECO:0000269|PubMed:23021213 51..61
Ion_trans_2 <138..196 CDD:462301 23/53 (43%)
Selectivity filter 1. /evidence=ECO:0000305|PubMed:26919430 157..162 3/4 (75%)
Ion_trans_2 234..312 CDD:462301 23/83 (28%)
Selectivity filter 2. /evidence=ECO:0000305|PubMed:26919430 266..271 4/4 (100%)
Interaction with AKAP5. /evidence=ECO:0000250|UniProtKB:P97438 313..326 2/12 (17%)
Essential for chloroform and halothane sensitivity. /evidence=ECO:0000250|UniProtKB:P97438 337..385 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.