DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and Kcnk2

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_742039.1 Gene:Kcnk2 / 170899 RGDID:621448 Length:426 Species:Rattus norvegicus


Alignment Length:291 Identity:62/291 - (21%)
Similarity:102/291 - (35%) Gaps:116/291 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSK 664
            |:...:|.::.||:||||:||::|||..|:|..:.||..||||....|:..|..|.    .:|.|
  Rat   142 WDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLG----TIFGK 202

  Fly   665 ALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGA 729
            .:.                                            .|.|.|            
  Rat   203 GIA--------------------------------------------KVEDTF------------ 211

  Fly   730 PPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPI 794
                              ...:.|:::     :.|::.|:......::::...|.:...:|.|..
  Rat   212 ------------------IKWNVSQTK-----IRIISTIIFILFGCVLFVALPAVIFKHIEGWSA 253

  Fly   795 LDGIYFCFMSLSTIGFGDMLPGLRRESN--------ATTWFCSVYIMSGMTLTAMCFNVIHE--- 848
            ||.|||..::|:||||||.:.|   .|:        ...||   :|:.|:...|...::|.:   
  Rat   254 LDAIYFVVITLTTIGFGDYVAG---GSDIEYLDFYKPVVWF---WILVGLAYFAAVLSMIGDWLR 312

  Fly   849 -------EIVHRIR---------IVVEFKKT 863
                   |.|...|         :..|||:|
  Rat   313 VISKKTKEEVGEFRAHAAEWTANVTAEFKET 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 24/55 (44%)
Ion_trans <601..640 CDD:278921 16/38 (42%)
Ion_trans_2 774..846 CDD:285168 22/79 (28%)
Kcnk2NP_742039.1 Ion_trans_2 <139..196 CDD:285168 23/53 (43%)
Ion_trans_2 234..312 CDD:285168 23/83 (28%)
Required for basal channel activity. /evidence=ECO:0000250|UniProtKB:P97438 354..426
Essential for chloroform and halothane sensitivity. /evidence=ECO:0000250|UniProtKB:P97438 378..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9664
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.