DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and Kcnk7

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_034739.2 Gene:Kcnk7 / 16530 MGIID:1341841 Length:343 Species:Mus musculus


Alignment Length:299 Identity:65/299 - (21%)
Similarity:111/299 - (37%) Gaps:94/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   583 RAGGVGGVAVGGGPPHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYL 647
            :|.||..:. .......|:...|.|::.::|||.|||::||.::.|:...:.||..|:|.:|..:
Mouse    74 QAHGVSSLG-NSSETSNWDLPSALLFTASILTTTGYGHMAPLSSGGKAFCVVYAALGLPASLALV 137

  Fly   648 SSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYY 712
            ::    |......|||                             |......:|.|.|..|    
Mouse   138 AA----LRHCLLPVFS-----------------------------RPGDWVAIRWQLAPAQ---- 165

  Fly   713 VRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMII 777
                  |...:.||.|.                                      ::.|     :
Mouse   166 ------AALLQAAGLGL--------------------------------------LVAC-----V 181

  Fly   778 YIVFGAAVLYRLE-KWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTWFCSVYIMSG---MTL 838
            :::..|.||:.:: ...:|:.|||||.||||||.||:||...|..:...:....:.:.|   :.|
Mouse   182 FMLLPALVLWGVQGDCSLLEAIYFCFGSLSTIGLGDLLPAHGRGLHPAIYHLGQFALLGYLLLGL 246

  Fly   839 TAMCFNVIHEEIVHRIRIVVEFKKTSAANSG---GGLIG 874
            .||...|.....:.::|.:|:|...|.:.:.   .|::|
Mouse   247 LAMLLAVETFSELPQVRAMVKFFGPSGSRTDEDQDGILG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 18/56 (32%)
Ion_trans <601..640 CDD:278921 13/38 (34%)
Ion_trans_2 774..846 CDD:285168 24/75 (32%)
Kcnk7NP_034739.2 Ion_trans_2 <89..140 CDD:285168 17/54 (31%)
Ion_trans_2 178..>225 CDD:285168 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.