DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and spp-30

DIOPT Version :10

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001257164.1 Gene:spp-30 / 13222892 WormBaseID:WBGene00206537 Length:117 Species:Caenorhabditis elegans


Alignment Length:86 Identity:17/86 - (19%)
Similarity:27/86 - (31%) Gaps:19/86 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   768 ILLCFSMMIIYIVFGAAVLYRLEKWPILDGIYFCFMSLSTI--GFGDMLPGLRRESNATTWFCSV 830
            :|.||:.|            .....|| |...:|...|..:  .||..:...|:..|.....|..
 Worm    11 LLACFTKM------------SCTSKPI-DNCTYCVNVLKCVFGHFGKSVKSKRQLGNKLVATCKR 62

  Fly   831 YIMSGMTLTAMCFNVIHEEIV 851
            |    ....:.|..|:...::
 Worm    63 Y----SQYRSRCIRVVKSNLL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:462301
Ion_trans_2 774..846 CDD:462301 13/73 (18%)
spp-30NP_001257164.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.