DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and Kcnk6

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_446258.2 Gene:Kcnk6 / 116491 RGDID:621450 Length:313 Species:Rattus norvegicus


Alignment Length:258 Identity:59/258 - (22%)
Similarity:94/258 - (36%) Gaps:91/258 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 NNPATEAVLLHTHYHHHRAGGVGGVAV---GGGPPH----EWNFAKAFLYSLTVLTTIGYGNVAP 623
            ::|...|..|........|.|..|.||   ..||.:    .|:||.|..::.|::||:|||...|
  Rat    50 HSPCVAAHALDAFVERVLAAGRLGRAVLANASGPANASDPAWDFASALFFASTLVTTVGYGYTTP 114

  Fly   624 RTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKE 688
            .|..|:..::.:|..|:|:|::.|:::...|:.    :.:.|....|....|:            
  Rat   115 LTDAGKAFSIVFALLGVPITMLLLTASAQRLSL----LLTHAPLSWLSLRWGW------------ 163

  Fly   689 RRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSAS 753
                                         |  |::.|                            
  Rat   164 -----------------------------H--PQRAA---------------------------- 169

  Fly   754 ESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLPG 816
                ..|.:::|..|:..|     :::..|...|..|.|..||..||||:||||||.||.:||
  Rat   170 ----RWHLVALLMVIVAIF-----FLIPAAVFAYLEEAWSFLDAFYFCFISLSTIGLGDYVPG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 19/56 (34%)
Ion_trans <601..640 CDD:278921 13/38 (34%)
Ion_trans_2 774..846 CDD:285168 20/43 (47%)
Kcnk6NP_446258.2 Ion_trans_2 <91..146 CDD:400301 18/54 (33%)
Ion_trans_2 180..259 CDD:400301 22/49 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.